SCOP 1.57: Domain d1b6la_: 1b6l A:

Lineage for d1b6la_ (1b6l A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)

8. Domain d1b6la_: 1b6l A: [26571]

Details for d1b6la_

PDB Entry: 1b6l, 1.75 Å

PDB Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 4

SCOP Domain Sequences for d1b6la_:

Sequence, based on SEQRES records:

>d1b6la_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Sequence, based on observed residues (ATOM records):

>d1b6la_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveighkaigtvlvgptpvniigrnlltqigtlnf

Timeline for d1b6la_:

• d1b6la_ first appeared (with stable ids) in SCOP 1.55
  
• d1b6la_ appears in SCOP 1.59
  
• d1b6la_ appears in the current release, SCOPe 2.08