Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) |
Family f.23.10.0: automated matches [227192] (1 protein) not a true family |
Protein automated matches [226917] (3 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267910] (3 PDB entries) |
Domain d3wmmh1: 3wmm H:2-43 [265700] Other proteins in same PDB: d3wmm0_, d3wmm2_, d3wmm4_, d3wmm6_, d3wmm8_, d3wmmb_, d3wmmc_, d3wmme_, d3wmmg_, d3wmmh2, d3wmmj_, d3wmmm_, d3wmmn_, d3wmmp_, d3wmmr_, d3wmmt_, d3wmmv_, d3wmmx_, d3wmmz_ automated match to d1eysh2 complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8 |
PDB Entry: 3wmm (more details), 3.01 Å
SCOPe Domain Sequences for d3wmmh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmmh1 f.23.10.0 (H:2-43) automated matches {Thermochromatium tepidum [TaxId: 1050]} sagithyidaaqitiwafwlfffgliiylrredkregyplds
Timeline for d3wmmh1: