Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (2 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267909] (1 PDB entry) |
Domain d3wmmg_: 3wmm G: [265699] Other proteins in same PDB: d3wmmc_, d3wmmh1, d3wmmh2, d3wmmm_ automated match to d1wrga_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8 |
PDB Entry: 3wmm (more details), 3.01 Å
SCOPe Domain Sequences for d3wmmg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmmg_ f.3.1.0 (G:) automated matches {Thermochromatium tepidum [TaxId: 1050]} tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
Timeline for d3wmmg_: