Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (10 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries) |
Domain d3wmm8_: 3wmm 8: [265695] Other proteins in same PDB: d3wmmc_, d3wmmh1, d3wmmh2, d3wmmm_ automated match to d1wrga_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8 |
PDB Entry: 3wmm (more details), 3.01 Å
SCOPe Domain Sequences for d3wmm8_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmm8_ f.3.1.0 (8:) automated matches {Thermochromatium tepidum [TaxId: 1050]} tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
Timeline for d3wmm8_:
View in 3D Domains from other chains: (mouse over for more information) d3wmm0_, d3wmm1_, d3wmm2_, d3wmm3_, d3wmm4_, d3wmm5_, d3wmm6_, d3wmm7_, d3wmm9_, d3wmma_, d3wmmb_, d3wmmc_, d3wmmd_, d3wmme_, d3wmmf_, d3wmmg_, d3wmmh1, d3wmmh2, d3wmmi_, d3wmmj_, d3wmmk_, d3wmmm_, d3wmmn_, d3wmmo_, d3wmmp_, d3wmmq_, d3wmmr_, d3wmms_, d3wmmt_, d3wmmu_, d3wmmv_, d3wmmw_, d3wmmx_, d3wmmy_, d3wmmz_ |