SCOPe 2.05: Domain d3whca1: 3whc A:4-77

Lineage for d3whca1 (3whc A:4-77)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (16 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [267907] (2 PDB entries)

8. Domain d3whca1: 3whc A:4-77 [265651]
   Other proteins in same PDB: d3whca2, d3whcb2, d3whcc2, d3whcd2, d3whce2, d3whcf2
   automated match to d1vi0a1
   complexed with st9

Details for d3whca1

PDB Entry: 3whc, 2.2 Å

PDB Description: crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa

PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whca1:

Sequence; same for both SEQRES and ATOM records:

>d3whca1 a.4.1.0 (A:4-77) automated matches {Bacillus subtilis [TaxId: 224308]}
krpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmg
qfiermeedikeka

Timeline for d3whca1:

• d3whca1 is new in SCOPe 2.05-stable
  
• d3whca1 appears in SCOPe 2.06
  
• d3whca1 appears in the current release, SCOPe 2.08