Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (22 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [267907] (2 PDB entries) |
Domain d3whba1: 3whb A:5-77 [265647] Other proteins in same PDB: d3whba2, d3whbb2 automated match to d1vi0a1 complexed with dcc |
PDB Entry: 3whb (more details), 2.15 Å
SCOPe Domain Sequences for d3whba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3whba1 a.4.1.0 (A:5-77) automated matches {Bacillus subtilis [TaxId: 224308]} rpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgq fiermeedikeka
Timeline for d3whba1: