SCOPe 2.05: Domain d3wfel2: 3wfe L:108-213

Lineage for d3wfel2 (3wfe L:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3wfel2: 3wfe L:108-213 [265642]
   Other proteins in same PDB: d3wfel1
   automated match to d2fd6l2
   complexed with 10m, ca, cyn, fe, hec, hem

Details for d3wfel2

PDB Entry: 3wfe, 2.49 Å

PDB Description: reduced and cyanide-bound cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment

PDB Compounds: (L:) antibody fab fragment light chain

SCOPe Domain Sequences for d3wfel2:

Sequence; same for both SEQRES and ATOM records:

>d3wfel2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3wfel2:

• d3wfel2 is new in SCOPe 2.05-stable
  
• d3wfel2 appears in SCOPe 2.06
  
• d3wfel2 appears in the current release, SCOPe 2.08