SCOPe 2.05: Domain d3wceb_: 3wce B:

Lineage for d3wceb_ (3wce B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (30 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [256465] (6 PDB entries)

8. Domain d3wceb_: 3wce B: [265604]
   automated match to d3wcba_
   complexed with er4

Details for d3wceb_

PDB Entry: 3wce, 2.75 Å

PDB Description: The complex structure of TcSQS with ligand, ER119884

PDB Compounds: (B:) Farnesyltransferase, putative

SCOPe Domain Sequences for d3wceb_:

Sequence; same for both SEQRES and ATOM records:

>d3wceb_ a.128.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
dedlrfcydilqavsrsfavvimeldeemrdavcifylvlraldtveddmsipvefklre
lpkfhehlhdttwcmsgvgvgrerellerythvtraysrlgkayqdvisgicermangmc
dfltrkvetkadydlychyvaglvghgltllyvssgledvrladdltnanhmglflqktn
iirdfyedicevpprvfwpreiwekytddlhafkdelheakaveclnamvadalvhvphv
veylaslrdpsvfafsaipqvmamatlslvfnnkdvfhtkvkttrgatarifhystelqa
tlqmlktytlrlaarmnaqdacydriehlvndairameshq

Timeline for d3wceb_:

• d3wceb_ is new in SCOPe 2.05-stable
  
• d3wceb_ appears in SCOPe 2.06
  
• d3wceb_ appears in the current release, SCOPe 2.08