Lineage for d1g6la2 (1g6l A:1001-1099)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. Domain d1g6la2: 1g6l A:1001-1099 [26560]

Details for d1g6la2

PDB Entry: 1g6l (more details), 1.9 Å

PDB Description: 1.9a crystal structure of tethered hiv-1 protease

SCOP Domain Sequences for d1g6la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6la2 b.50.1.1 (A:1001-1099) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1g6la2 are not available.

Timeline for d1g6la2:

Domains from same chain:
(mouse over for more information)
d1g6la1