SCOPe 2.08: Domain d3wbxb_: 3wbx B:

Lineage for d3wbxb_ (3wbx B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (31 species)
   not a true protein

7. Species Gluconobacter oxydans [TaxId:290633] [256462] (2 PDB entries)

8. Domain d3wbxb_: 3wbx B: [265592]
   automated match to d3f7ja_
   complexed with so4

Details for d3wbxb_

PDB Entry: 3wbx, 2.4 Å

PDB Description: Crystal structure of Gox0644 at apoform

PDB Compounds: (B:) Putative 2,5-diketo-D-gluconic acid reductase

SCOPe Domain Sequences for d3wbxb_:

Sequence; same for both SEQRES and ATOM records:

>d3wbxb_ c.1.7.0 (B:) automated matches {Gluconobacter oxydans [TaxId: 290633]}
eaqtvisfhdghtmpqiglgvwetppdetaevvkeavklgyrsvdtarlykneegvgkgl
edhpeiflttklwndeqgydstlrayeesarllrrpvldlylihwpmpaqgqyvetwkal
velkksgrvksigvsnfesehlerimdatgvvpvvnqielhpdfqqralrefhekhnirt
eswrplgkgrvlsderigkiaekhsrtpaqvvirwhlqnglivipksvnpkrlaenldvf
gfvldaddmqaieqmdrkdgrmgadpntakf

Timeline for d3wbxb_:

• d3wbxb_ first appeared in SCOPe 2.05
  
• d3wbxb_ appears in SCOPe 2.07