SCOPe 2.08: Domain d3vcnc1: 3vcn C:1-112

Lineage for d3vcnc1 (3vcn C:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:155892] [267902] (1 PDB entry)

8. Domain d3vcnc1: 3vcn C:1-112 [265569]
   Other proteins in same PDB: d3vcna2, d3vcnc2
   automated match to d4il2a1
   complexed with cl, co3, gol, mg

Details for d3vcnc1

PDB Entry: 3vcn, 1.45 Å

PDB Description: Crystal structure of mannonate dehydratase (target EFI-502209) from Caulobacter crescentus CB15

PDB Compounds: (C:) Mannonate dehydratase

SCOPe Domain Sequences for d3vcnc1:

Sequence; same for both SEQRES and ATOM records:

>d3vcnc1 d.54.1.0 (C:1-112) automated matches {Caulobacter crescentus [TaxId: 155892]}
mlkiidakvivtcpgrnfvtlkittedgitgvgdatlngrelsvvsflqdhmvpsligrd
ahqiediwqffyrgsywrggpvamtalaavdmalwdikgkvaglpvyqllgg

Timeline for d3vcnc1:

• d3vcnc1 first appeared in SCOPe 2.05
  
• d3vcnc1 appears in SCOPe 2.07