SCOPe 2.08: Domain d3v3wa1: 3v3w A:1-111

Lineage for d3v3wa1 (3v3w A:1-111)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Cellvibrio japonicus [TaxId:498211] [267898] (2 PDB entries)

8. Domain d3v3wa1: 3v3w A:1-111 [265552]
   Other proteins in same PDB: d3v3wa2
   automated match to d4il2a1
   complexed with cl, gol, mg, nhe

Details for d3v3wa1

PDB Entry: 3v3w, 1.4 Å

PDB Description: crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol

PDB Compounds: (A:) Starvation sensing protein rspA

SCOPe Domain Sequences for d3v3wa1:

Sequence; same for both SEQRES and ATOM records:

>d3v3wa1 d.54.1.0 (A:1-111) automated matches {Cellvibrio japonicus [TaxId: 498211]}
mkivdakvivtcpgrnfvtlkivtdqgiygigdatlngreksvvsyledylipvligrdp
qqiediwqffyrgaywrrgpvgmtalaaidvalwdikaklanmplyqllgg

Timeline for d3v3wa1:

• d3v3wa1 first appeared in SCOPe 2.05
  
• d3v3wa1 appears in SCOPe 2.07