Lineage for d3uyya_ (3uyy A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573213Species Deinococcus radiodurans [TaxId:1299] [267897] (3 PDB entries)
  8. 2573216Domain d3uyya_: 3uyy A: [265544]
    automated match to d4dqna_
    complexed with plp

Details for d3uyya_

PDB Entry: 3uyy (more details), 2.5 Å

PDB Description: Crystal Structures of Branched-Chain Aminotransferase from Deinococcus radiodurans Complexes with alpha-Ketoisocaproate and L-Glutamate Suggest Its Radio-Resistance for Catalysis
PDB Compounds: (A:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3uyya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uyya_ e.17.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
idwstlgfsyirtdlrylahwkdgewdagtltednqihlaegstalhygqqcfeglkayr
cadgsinlfrpdqnaarmrmscrrllmpelsdeqfidaclqvvranehflppygtggsly
lrpfvigvgdnigvrtapefifsvfcvpvgpyfkggltptnfitsdydraaphgtgaakv
ggnyaasllpgyeakkrdfadviyldpathttieeagaanffaitqdgqkfvtpqspsil
psitkysllwlaehrlgleveegdiridelgkfseagacgtaavitpiggiqhgddfhvf
ysesepgpvtrrlydelvgiqygdkeapegwivkv

SCOPe Domain Coordinates for d3uyya_:

Click to download the PDB-style file with coordinates for d3uyya_.
(The format of our PDB-style files is described here.)

Timeline for d3uyya_: