Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
Domain d3uwta2: 3uwt A:218-313 [265543] Other proteins in same PDB: d3uwta3 automated match to d2mpua_ complexed with cl |
PDB Entry: 3uwt (more details), 2.5 Å
SCOPe Domain Sequences for d3uwta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uwta2 d.58.7.0 (A:218-313) automated matches {Human (Homo sapiens) [TaxId: 9606]} laeearafnriyvasvhqdlsdddiksvfeafgkiksctlardpttgkhkgygfieyeka qssqdavssmnlfdlggqylrvgkavtppmplltpa
Timeline for d3uwta2: