SCOPe 2.06: Domain d3uryb2: 3ury B:208-308

Lineage for d3uryb2 (3ury B:208-308)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226096] (6 PDB entries)

8. Domain d3uryb2: 3ury B:208-308 [265541]
   Other proteins in same PDB: d3urya1, d3uryb1
   automated match to d4rcob2
   complexed with cl

Details for d3uryb2

PDB Entry: 3ury, 1.9 Å

PDB Description: crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus subsp. aureus nctc 8325

PDB Compounds: (B:) Exotoxin

SCOPe Domain Sequences for d3uryb2:

Sequence; same for both SEQRES and ATOM records:

>d3uryb2 d.15.6.0 (B:208-308) automated matches {Staphylococcus aureus [TaxId: 93061]}
kvdhkagvritkednkgtishdvsefkitkeqislkeldfklrkqlieknnlygnvgsgk
ivikmknggkytfelhkklqenrmadvidgtnidnievnik

Timeline for d3uryb2:

• d3uryb2 first appeared in SCOPe 2.05
  
• d3uryb2 appears in SCOPe 2.07
  
• d3uryb2 appears in the current release, SCOPe 2.08