Lineage for d3uryb2 (3ury B:208-308)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934618Species Staphylococcus aureus [TaxId:93061] [226096] (8 PDB entries)
  8. 2934625Domain d3uryb2: 3ury B:208-308 [265541]
    Other proteins in same PDB: d3urya1, d3uryb1
    automated match to d4rcob2
    complexed with cl

Details for d3uryb2

PDB Entry: 3ury (more details), 1.9 Å

PDB Description: crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus subsp. aureus nctc 8325
PDB Compounds: (B:) Exotoxin

SCOPe Domain Sequences for d3uryb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uryb2 d.15.6.0 (B:208-308) automated matches {Staphylococcus aureus [TaxId: 93061]}
kvdhkagvritkednkgtishdvsefkitkeqislkeldfklrkqlieknnlygnvgsgk
ivikmknggkytfelhkklqenrmadvidgtnidnievnik

SCOPe Domain Coordinates for d3uryb2:

Click to download the PDB-style file with coordinates for d3uryb2.
(The format of our PDB-style files is described here.)

Timeline for d3uryb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uryb1