| Class b: All beta proteins [48724] (176 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
| Protein automated matches [226834] (5 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93061] [226094] (6 PDB entries) |
| Domain d3uryb1: 3ury B:116-207 [265540] Other proteins in same PDB: d3urya2, d3uryb2 automated match to d4rcob1 complexed with cl |
PDB Entry: 3ury (more details), 1.9 Å
SCOPe Domain Sequences for d3uryb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uryb1 b.40.2.0 (B:116-207) automated matches {Staphylococcus aureus [TaxId: 93061]}
inpkfkdlrayytkpslefkneigiilkkwttirfmnvvpdyfiykialvgkddkkygeg
vhrnvdvfvvleennynlekysvggitksnsk
Timeline for d3uryb1: