SCOPe 2.08: Domain d3uorb_: 3uor B:

Lineage for d3uorb_ (3uor B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [225275] (3 PDB entries)

8. Domain d3uorb_: 3uor B: [265537]
   automated match to d4rjza_

Details for d3uorb_

PDB Entry: 3uor, 2.2 Å

PDB Description: the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri

PDB Compounds: (B:) ABC transporter sugar binding protein

SCOPe Domain Sequences for d3uorb_:

Sequence; same for both SEQRES and ATOM records:

>d3uorb_ c.94.1.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
ttvrfwamgkeaevvaelvadfekqnptihvdvqnipmtaaheklltafaadglpdvcql
gntwlpefalldtlepmqpyvarskivdpadyfpgvwdtnlvdgtlygvpwyvdtrllfy
rkdllreagysqmpktwaemeqvmaaikrkvgpdryailmplnefeqqlsfalqqddrll
rdhdnygnfrgagfrkalgfydnmyqqgwapkvsetqvsnvwyeffngyyafylsgpwnv
refklrqppgmegnwgtaplpgpnglgagiaggsslvifkssqhkdaswklieylsqpqv
qarfhaiigdlpprrstwklpslandalahafgdqlervkatpkvlewerivqemrlvte
rvvrggqshdaavqeldqrvdeilakrrwifeqeg

Timeline for d3uorb_:

• d3uorb_ first appeared in SCOPe 2.05
  
• d3uorb_ appears in SCOPe 2.07