Lineage for d3uora_ (3uor A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916446Species Xanthomonas axonopodis [TaxId:190486] [225275] (3 PDB entries)
  8. 2916450Domain d3uora_: 3uor A: [265536]
    automated match to d4rjza_

Details for d3uora_

PDB Entry: 3uor (more details), 2.2 Å

PDB Description: the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri
PDB Compounds: (A:) ABC transporter sugar binding protein

SCOPe Domain Sequences for d3uora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uora_ c.94.1.0 (A:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
kttvrfwamgkeaevvaelvadfekqnptihvdvqnipmtaaheklltafaadglpdvcq
lgntwlpefalldtlepmqpyvarskivdpadyfpgvwdtnlvdgtlygvpwyvdtrllf
yrkdllreagysqmpktwaemeqvmaaikrkvgpdryailmplnefeqqlsfalqqddrl
lrdhdnygnfrgagfrkalgfydnmyqqgwapkvsetqvsnvwyeffngyyafylsgpwn
vrefklrqppgmegnwgtaplpgpnglgagiaggsslvifkssqhkdaswklieylsqpq
vqarfhaiigdlpprrstwklpslandalahafgdqlervkatpkvlewerivqemrlvt
ervvrggqshdaavqeldqrvdeilakrrwifeqegg

SCOPe Domain Coordinates for d3uora_:

Click to download the PDB-style file with coordinates for d3uora_.
(The format of our PDB-style files is described here.)

Timeline for d3uora_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3uorb_