SCOPe 2.08: Domain d3uk7b2: 3uk7 B:191-388

Lineage for d3uk7b2 (3uk7 B:191-388)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (3 PDB entries)

8. Domain d3uk7b2: 3uk7 B:191-388 [265523]
   Other proteins in same PDB: d3uk7c3
   automated match to d1oi4a1

Details for d3uk7b2

PDB Entry: 3uk7, 2.05 Å

PDB Description: Crystal Structure of Arabidopsis thaliana DJ-1D

PDB Compounds: (B:) Class I glutamine amidotransferase-like domain-containing protein

SCOPe Domain Sequences for d3uk7b2:

Sequence; same for both SEQRES and ATOM records:

>d3uk7b2 c.23.16.0 (B:191-388) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gkitgankrilflcgdymedyevkvpfqslqalgcqvdavcpekkagdrcptaihdfegd
qtysekpghtfalttnfddlvsssydalvipggrapeylalnehvlnivkefmnsekpva
sichgqqilaaagvlkgrkctaypavklnvvlgggtwlepdpidrcftdgnlvtgaawpg
hpefvsqlmallgiqvsf

Timeline for d3uk7b2:

• d3uk7b2 first appeared in SCOPe 2.05
  
• d3uk7b2 appears in SCOPe 2.07