SCOPe 2.08: Domain d1dw6c_: 1dw6 C:

Lineage for d1dw6c_ (1dw6 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1dw6c_: 1dw6 C: [26545]
   complexed with 0q4; mutant

Details for d1dw6c_

PDB Entry: 1dw6, 1.88 Å

PDB Description: structural and kinetic analysis of drug resistant mutants of hiv-1 protease

PDB Compounds: (C:) hiv-1 protease

SCOPe Domain Sequences for d1dw6c_:

Sequence; same for both SEQRES and ATOM records:

>d1dw6c_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf

Timeline for d1dw6c_:

• d1dw6c_ first appeared (with stable ids) in SCOP 1.55
  
• d1dw6c_ appears in SCOPe 2.07