Lineage for d1d4kb_ (1d4k B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15757Domain d1d4kb_: 1d4k B: [26544]

Details for d1d4kb_

PDB Entry: 1d4k (more details), 1.85 Å

PDB Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor

SCOP Domain Sequences for d1d4kb_:

Sequence, based on SEQRES records: (download)

>d1d4kb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Sequence, based on observed residues (ATOM records): (download)

>d1d4kb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveighkaigtvlvgptpvniigrnlltqigtlnf

SCOP Domain Coordinates for d1d4kb_:

Click to download the PDB-style file with coordinates for d1d4kb_.
(The format of our PDB-style files is described here.)

Timeline for d1d4kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d4ka_