SCOPe 2.06: Domain d3tlkc1: 3tlk C:28-318

Lineage for d3tlkc1 (3tlk C:28-318)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (35 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [256409] (3 PDB entries)

8. Domain d3tlkc1: 3tlk C:28-318 [265399]
   Other proteins in same PDB: d3tlka2, d3tlkc2
   automated match to d2m6ka_
   complexed with dio, eb4, fe

Details for d3tlkc1

PDB Entry: 3tlk, 1.85 Å

PDB Description: Crystal structure of holo FepB

PDB Compounds: (C:) Ferrienterobactin-binding periplasmic protein

SCOPe Domain Sequences for d3tlkc1:

Sequence; same for both SEQRES and ATOM records:

>d3tlkc1 c.92.2.0 (C:28-318) automated matches {Escherichia coli [TaxId: 83333]}
dwprqitdsrgthtlesqpqrivstsvtltgsllaidapviasgattpnnrvaddqgflr
qwskvakerklqrlyigepsaeavaaqmpdlilisatggdsalalydqlstiaptliiny
ddkswqslltqlgeitghekqaaeriaqfdkqlaaakeqiklppqpvtaivytaaahsan
lwtpesaqgqmleqlgftlaklpaglnasqsqgkrhdiiqlggenlaaglngeslflfag
dqkdadaiyanpllahlpavqnkqvyalgtetfrldyysamqvldrlkalf

Timeline for d3tlkc1:

• d3tlkc1 first appeared in SCOPe 2.05, called d3tlkc_
  
• d3tlkc1 appears in SCOPe 2.07
  
• d3tlkc1 appears in the current release, SCOPe 2.08