Lineage for d3tjia2 (3tji A:116-399)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824098Species Enterobacter sp. [TaxId:399742] [267888] (1 PDB entry)
  8. 1824099Domain d3tjia2: 3tji A:116-399 [265387]
    Other proteins in same PDB: d3tjia1, d3tjib1, d3tjic1, d3tjid1
    automated match to d3gy1a2
    complexed with cl, gol, mg

Details for d3tjia2

PDB Entry: 3tji (more details), 1.8 Å

PDB Description: crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d3tjia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tjia2 c.1.11.0 (A:116-399) automated matches {Enterobacter sp. [TaxId: 399742]}
ksrdaipayshasgetlealfasvdaliaqgyrhircqlgfyggtpsalhapdnptpgaw
fdqqeymsntvemfhalrekygwklhilhdvherlfpqqavqlakqlepfqpyfiedilp
pqqsawleqvrqqscvplalgelfnnpaewhdlivnrridfirchvsqiggitpalklah
lcqafgvrlawhgpgdmtpigvavnthlnihlhnaaiqefiprsattndvfpgapevkeg
fvyppvqpgigvgfnealalahpvlyrphewtqsrlpdgtihtp

SCOPe Domain Coordinates for d3tjia2:

Click to download the PDB-style file with coordinates for d3tjia2.
(The format of our PDB-style files is described here.)

Timeline for d3tjia2: