Lineage for d3sudc_ (3sud C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795140Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1795230Protein automated matches [190658] (4 species)
    not a true protein
  7. 1795236Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (19 PDB entries)
  8. 1795250Domain d3sudc_: 3sud C: [265373]
    automated match to d3sv6a_
    complexed with so4, sue, zn

Details for d3sudc_

PDB Entry: 3sud (more details), 1.96 Å

PDB Description: crystal structure of ns3/4a protease in complex with mk-5172
PDB Compounds: (C:) NS3 protease, NS4A protein

SCOPe Domain Sequences for d3sudc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sudc_ b.47.1.3 (C:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
kgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsi
ngvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvt
rhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstrgvakavd
fipvesl

SCOPe Domain Coordinates for d3sudc_:

Click to download the PDB-style file with coordinates for d3sudc_.
(The format of our PDB-style files is described here.)

Timeline for d3sudc_: