SCOPe 2.06: Domain d3sbfc1: 3sbf C:5-117

Lineage for d3sbfc1 (3sbf C:5-117)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Vibrionales bacterium [TaxId:391574] [267877] (3 PDB entries)

8. Domain d3sbfc1: 3sbf C:5-117 [265354]
   Other proteins in same PDB: d3sbfa2, d3sbfb2, d3sbfc2, d3sbfd2, d3sbfd3
   automated match to d3gy1a1
   complexed with d8t, epe, mg; mutant

Details for d3sbfc1

PDB Entry: 3sbf, 1.5 Å

PDB Description: crystal structure of the mutant p311a of enolase superfamily member from vibrionales bacterium complexed with mg and d-arabinonate

PDB Compounds: (C:) Mandelate racemase / muconate lactonizing enzyme

SCOPe Domain Sequences for d3sbfc1:

Sequence; same for both SEQRES and ATOM records:

>d3sbfc1 d.54.1.0 (C:5-117) automated matches {Vibrionales bacterium [TaxId: 391574]}
etiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpiligk
nanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg

Timeline for d3sbfc1:

• d3sbfc1 first appeared in SCOPe 2.05
  
• d3sbfc1 appears in SCOPe 2.07
  
• d3sbfc1 appears in the current release, SCOPe 2.08