Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (13 species) not a true protein |
Species Vibrionales bacterium [TaxId:391574] [267878] (2 PDB entries) |
Domain d3sbfa2: 3sbf A:118-401 [265351] Other proteins in same PDB: d3sbfa1, d3sbfb1, d3sbfc1, d3sbfd1, d3sbfd3 automated match to d3gy1a2 complexed with d8t, epe, mg; mutant |
PDB Entry: 3sbf (more details), 1.5 Å
SCOPe Domain Sequences for d3sbfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbfa2 c.1.11.2 (A:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]} ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh lcqnfgvriawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping ylyaseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
Timeline for d3sbfa2: