Lineage for d3rgtc2 (3rgt C:114-405)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099539Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)
  8. 2099582Domain d3rgtc2: 3rgt C:114-405 [265327]
    Other proteins in same PDB: d3rgta1, d3rgta3, d3rgtb1, d3rgtb3, d3rgtc1, d3rgtc3, d3rgtd1, d3rgtd3
    automated match to d4il2a2
    complexed with co, ez4

Details for d3rgtc2

PDB Entry: 3rgt (more details), 1.9 Å

PDB Description: Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with D-Arabinohydroxamate
PDB Compounds: (C:) D-mannonate dehydratase

SCOPe Domain Sequences for d3rgtc2:

Sequence, based on SEQRES records: (download)

>d3rgtc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d3rgtc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgislpaehvwstekylnh
apklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrl
irehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrt
gfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespg
hgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d3rgtc2:

Click to download the PDB-style file with coordinates for d3rgtc2.
(The format of our PDB-style files is described here.)

Timeline for d3rgtc2: