Lineage for d3rgtb2 (3rgt B:114-405)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837377Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)
  8. 2837419Domain d3rgtb2: 3rgt B:114-405 [265325]
    Other proteins in same PDB: d3rgta1, d3rgta3, d3rgtb1, d3rgtb3, d3rgtc1, d3rgtc3, d3rgtd1, d3rgtd3
    automated match to d4il2a2
    complexed with co, ez4

Details for d3rgtb2

PDB Entry: 3rgt (more details), 1.9 Å

PDB Description: Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with D-Arabinohydroxamate
PDB Compounds: (B:) D-mannonate dehydratase

SCOPe Domain Sequences for d3rgtb2:

Sequence, based on SEQRES records: (download)

>d3rgtb2 c.1.11.0 (B:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d3rgtb2 c.1.11.0 (B:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvyepadsslpa
ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
edghflagespghgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d3rgtb2:

Click to download the PDB-style file with coordinates for d3rgtb2.
(The format of our PDB-style files is described here.)

Timeline for d3rgtb2: