SCOPe 2.05: Domain d3rgta1: 3rgt A:3-113

Lineage for d3rgta1 (3rgt A:3-113)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267864] (5 PDB entries)

8. Domain d3rgta1: 3rgt A:3-113 [265322]
   Other proteins in same PDB: d3rgta2, d3rgtb2, d3rgtc2, d3rgtd2
   automated match to d4il2a1
   complexed with co, ez4

Details for d3rgta1

PDB Entry: 3rgt, 1.9 Å

PDB Description: Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with D-Arabinohydroxamate

PDB Compounds: (A:) D-mannonate dehydratase

SCOPe Domain Sequences for d3rgta1:

Sequence; same for both SEQRES and ATOM records:

>d3rgta1 d.54.1.0 (A:3-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

Timeline for d3rgta1:

• d3rgta1 is new in SCOPe 2.05-stable
  
• d3rgta1 appears in SCOPe 2.06
  
• d3rgta1 appears in the current release, SCOPe 2.08