Lineage for d3r9qb_ (3r9q B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853886Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)
  8. 2853903Domain d3r9qb_: 3r9q B: [265315]
    automated match to d4qfea_
    complexed with cl, gol

Details for d3r9qb_

PDB Entry: 3r9q (more details), 2.1 Å

PDB Description: structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus atcc 19977 / dsm 44196
PDB Compounds: (B:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3r9qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9qb_ c.14.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
qpavrvekagpvttvilnrpharnavdgptaaallaaftefdadpeasvavlwgdngtfc
agadlkamgtdrgnelhphgpgpmgpsrlrlskpviaaisghavaggielalwcdlrvve
edavlgvfcrrwgvplidggtirlprlighsramdliltgrpvhanealdiglvnrvvar
gqareaaetlaaeiaafpqqcvradrdsaiaqwgmaeeaaldnefgsiervatealegag

SCOPe Domain Coordinates for d3r9qb_:

Click to download the PDB-style file with coordinates for d3r9qb_.
(The format of our PDB-style files is described here.)

Timeline for d3r9qb_: