Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (35 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [193580] (3 PDB entries) |
Domain d3r5sa1: 3r5s A:30-325 [265312] Other proteins in same PDB: d3r5sa2 automated match to d2m6ka_ |
PDB Entry: 3r5s (more details), 1.79 Å
SCOPe Domain Sequences for d3r5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r5sa1 c.92.2.0 (A:30-325) automated matches {Vibrio cholerae [TaxId: 666]} qnvwprtfqnadgsittipsqpkrilstavtvtgtllaidapviasaattqstffeqwrk laelrqvkklwpagsvdlesvyveqpdlivvsmigadsardqipllqaiaptilvdysdq twqslaqqlglatgleeqaertihnfeqwtkqvrdvldlpkgranivsyhgpgvvnavak aqsahaqllqsvgvvleepdpawqagsivhrdflrihyehltqlqaettflitmtdqqaq aflhdpilknlpsiqrkqvyglgensfridlfsareiinsllrrfageqaqslvmp
Timeline for d3r5sa1: