SCOPe 2.06: Domain d3r5sa1: 3r5s A:30-325

Lineage for d3r5sa1 (3r5s A:30-325)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (35 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [193580] (3 PDB entries)

8. Domain d3r5sa1: 3r5s A:30-325 [265312]
   Other proteins in same PDB: d3r5sa2
   automated match to d2m6ka_

Details for d3r5sa1

PDB Entry: 3r5s, 1.79 Å

PDB Description: Crystal structure of apo-ViuP

PDB Compounds: (A:) Ferric vibriobactin ABC transporter, periplasmic ferric vibriobactin-binding protein

SCOPe Domain Sequences for d3r5sa1:

Sequence; same for both SEQRES and ATOM records:

>d3r5sa1 c.92.2.0 (A:30-325) automated matches {Vibrio cholerae [TaxId: 666]}
qnvwprtfqnadgsittipsqpkrilstavtvtgtllaidapviasaattqstffeqwrk
laelrqvkklwpagsvdlesvyveqpdlivvsmigadsardqipllqaiaptilvdysdq
twqslaqqlglatgleeqaertihnfeqwtkqvrdvldlpkgranivsyhgpgvvnavak
aqsahaqllqsvgvvleepdpawqagsivhrdflrihyehltqlqaettflitmtdqqaq
aflhdpilknlpsiqrkqvyglgensfridlfsareiinsllrrfageqaqslvmp

Timeline for d3r5sa1:

• d3r5sa1 first appeared in SCOPe 2.05, called d3r5sa_
  
• d3r5sa1 appears in SCOPe 2.07
  
• d3r5sa1 appears in the current release, SCOPe 2.08