SCOP 1.57: Domain d2aidb_: 2aid B:

Lineage for d2aidb_ (2aid B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)

8. Domain d2aidb_: 2aid B: [26530]

Details for d2aidb_

PDB Entry: 2aid, 1.9 Å

PDB Description: structure of a non-peptide inhibitor complexed with hiv-1 protease: developing a cycle of structure-based drug design

SCOP Domain Sequences for d2aidb_:

Sequence; same for both SEQRES and ATOM records:

>d2aidb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2aidb_:

• d2aidb_ first appeared (with stable ids) in SCOP 1.55
  
• d2aidb_ appears in SCOP 1.59
  
• d2aidb_ appears in the current release, SCOPe 2.08