SCOPe 2.05: Domain d3r25a2: 3r25 A:118-401

Lineage for d3r25a2 (3r25 A:118-401)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (11 species)
   not a true protein

7. Species Vibrionales bacterium [TaxId:391574] [267878] (2 PDB entries)

8. Domain d3r25a2: 3r25 A:118-401 [265277]
   Other proteins in same PDB: d3r25a1, d3r25b1, d3r25c1, d3r25d1, d3r25e1, d3r25f1, d3r25g1, d3r25h1
   automated match to d3gy1a2
   complexed with gol, mg

Details for d3r25a2

PDB Entry: 3r25, 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Vibrionales bacterium complexed with Mg and Glycerol in the active site

PDB Compounds: (A:) Mandelate racemase / muconate lactonizing enzyme

SCOPe Domain Sequences for d3r25a2:

Sequence, based on SEQRES records:

>d3r25a2 c.1.11.2 (A:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy
ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp
pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh
lcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping
ylyaseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp

Sequence, based on observed residues (ATOM records):

>d3r25a2 c.1.11.2 (A:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqllhttqnptegsyydqdqymdn
tltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldn
irsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvri
awhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiag
igveidreaaaefpvmyrphewtqsrlpdgaihtp

Timeline for d3r25a2:

• d3r25a2 is new in SCOPe 2.05-stable
  
• d3r25a2 appears in SCOPe 2.06
  
• d3r25a2 appears in the current release, SCOPe 2.08