Lineage for d3r25a1 (3r25 A:3-117)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905930Species Vibrionales bacterium [TaxId:391574] [267877] (2 PDB entries)
  8. 1905935Domain d3r25a1: 3r25 A:3-117 [265276]
    Other proteins in same PDB: d3r25a2, d3r25b2, d3r25c2, d3r25d2, d3r25e2, d3r25f2, d3r25g2, d3r25h2
    automated match to d3gy1a1
    complexed with gol, mg

Details for d3r25a1

PDB Entry: 3r25 (more details), 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Vibrionales bacterium complexed with Mg and Glycerol in the active site
PDB Compounds: (A:) Mandelate racemase / muconate lactonizing enzyme

SCOPe Domain Sequences for d3r25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r25a1 d.54.1.0 (A:3-117) automated matches {Vibrionales bacterium [TaxId: 391574]}
lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg

SCOPe Domain Coordinates for d3r25a1:

Click to download the PDB-style file with coordinates for d3r25a1.
(The format of our PDB-style files is described here.)

Timeline for d3r25a1: