Lineage for d3r0qa_ (3r0q A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146982Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267876] (1 PDB entry)
  8. 2146983Domain d3r0qa_: 3r0q A: [265272]
    automated match to d4qppa_
    complexed with sah

Details for d3r0qa_

PDB Entry: 3r0q (more details), 2.61 Å

PDB Description: A Uniquely Open Conformation Revealed in the Crystal Structure of Arabidopsis Thaliana Protein Arginine Methyltransferase 10
PDB Compounds: (A:) Probable protein arginine N-methyltransferase 4.2

SCOPe Domain Sequences for d3r0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0qa_ c.66.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qyfctysflyhqkdmlsdrvrmdayfnavfqnkhhfegktvldvgtgsgilaiwsaqaga
rkvyaveatkmadharalvkannldhiveviegsvedislpekvdviisewmgyfllres
mfdsvisardrwlkptgvmypsharmwlapiksniadrkrndfdgamadwhnfsdeiksy
ygvdmgvltkpfaeeqekyyiqtamwndlnpqqiigtptivkemdcltasvseieevrsn
vtsvinmehtrlcgfggwfdvqfsgrkedpaqqeielttapseqhcthwgqqvfimsnpi
nveegdnlnlgllmsrskenhrlmeielnceikeasgnpkesfkktyfie

SCOPe Domain Coordinates for d3r0qa_:

Click to download the PDB-style file with coordinates for d3r0qa_.
(The format of our PDB-style files is described here.)

Timeline for d3r0qa_: