SCOPe 2.08: Domain d3qvmb_: 3qvm B:

Lineage for d3qvmb_ (3qvm B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Oleispira antarctica [TaxId:188908] [196342] (3 PDB entries)

8. Domain d3qvmb_: 3qvm B: [265271]
   automated match to d4hrxa_
   complexed with ca, cl, na, so4

Details for d3qvmb_

PDB Entry: 3qvm, 2 Å

PDB Description: the structure of olei00960, a hydrolase from oleispira antarctica

PDB Compounds: (B:) Olei00960

SCOPe Domain Sequences for d3qvmb_:

Sequence; same for both SEQRES and ATOM records:

>d3qvmb_ c.69.1.0 (B:) automated matches {Oleispira antarctica [TaxId: 188908]}
gmikqdvicyekedvvkrnninitgggektvllahgfgcdqnmwrfmlpelekqftvivf
dyvgsgqsdlesfstkrysslegyakdveeilvaldlvnvsiighsvssiiagiasthvg
drisditmicpspcfmnfppdyvggferddleelinlmdknyigwanylaplvmgashss
eligelsgsfcttdpivaktfakatffsdyrslledistpalifqsakdslaspevgqym
aenipnsqleliqaeghclhmtdaglitpllihfiqnnqt

Timeline for d3qvmb_:

• d3qvmb_ first appeared in SCOPe 2.05
  
• d3qvmb_ appears in SCOPe 2.07