SCOPe 2.08: Domain d3qr3a1: 3qr3 A:1-327

Lineage for d3qr3a1 (3qr3 A:1-327)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:51453] [267875] (1 PDB entry)

8. Domain d3qr3a1: 3qr3 A:1-327 [265268]
   Other proteins in same PDB: d3qr3a2, d3qr3a3, d3qr3b2, d3qr3b3
   automated match to d4lx4a_
   complexed with mg, so4

Details for d3qr3a1

PDB Entry: 3qr3, 2.05 Å

PDB Description: Crystal Structure of Cel5A (EG2) from Hypocrea jecorina (Trichoderma reesei)

PDB Compounds: (A:) Endoglucanase EG-II

SCOPe Domain Sequences for d3qr3a1:

Sequence; same for both SEQRES and ATOM records:

>d3qr3a1 c.1.8.0 (A:1-327) automated matches {Hypocrea jecorina [TaxId: 51453]}
gvrfagvniagfdfgcttdgtcvtskvypplknftgsnnypdgigqmqhfvnedgmtifr
lpvgwqylvnnnlggnldstsiskydqlvqgclslgaycivdihnyarwnggiigqggpt
naqftslwsqlaskyasqsrvwfgimnephdvnintwaatvqevvtairnagatsqfisl
pgndwqsagafisdgsaaalsqvtnpdgsttnlifdvhkyldsdnsgthaecttnnidga
fsplatwlrqnnrqailtetgggnvqsciqdmcqqiqylnqnsdvylgyvgwgagsfdst
yvltetptssgnswtdtslvssclark

Timeline for d3qr3a1:

• d3qr3a1 first appeared in SCOPe 2.05, called d3qr3a_
  
• d3qr3a1 appears in SCOPe 2.07