Lineage for d3qkeh2 (3qke H:114-405)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099539Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)
  8. 2099547Domain d3qkeh2: 3qke H:114-405 [265267]
    Other proteins in same PDB: d3qkea1, d3qkea3, d3qkeb1, d3qkeb3, d3qkec1, d3qkec3, d3qked1, d3qked3, d3qkee1, d3qkee3, d3qkef1, d3qkef3, d3qkeg1, d3qkeg3, d3qkeh1, d3qkeh3
    automated match to d4il2a2
    complexed with gco, mg

Details for d3qkeh2

PDB Entry: 3qke (more details), 1.55 Å

PDB Description: crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
PDB Compounds: (H:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qkeh2:

Sequence, based on SEQRES records: (download)

>d3qkeh2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d3qkeh2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvayepadsslp
aehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwle
dcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamr
rvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyr
fedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d3qkeh2:

Click to download the PDB-style file with coordinates for d3qkeh2.
(The format of our PDB-style files is described here.)

Timeline for d3qkeh2: