SCOPe 2.05: Domain d3qkea2: 3qke A:114-405

Lineage for d3qkea2 (3qke A:114-405)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267865] (5 PDB entries)

8. Domain d3qkea2: 3qke A:114-405 [265253]
   Other proteins in same PDB: d3qkea1, d3qkeb1, d3qkec1, d3qked1, d3qkee1, d3qkef1, d3qkeg1, d3qkeh1
   automated match to d4il2a2
   complexed with gco, mg

Details for d3qkea2

PDB Entry: 3qke, 1.55 Å

PDB Description: crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qkea2:

Sequence, based on SEQRES records:

>d3qkea2 c.1.11.0 (A:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d3qkea2 c.1.11.0 (A:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvayepadsslp
aehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwle
dcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamr
rvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyr
fedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Timeline for d3qkea2:

• d3qkea2 is new in SCOPe 2.05-stable
  
• d3qkea2 appears in SCOPe 2.06
  
• d3qkea2 appears in the current release, SCOPe 2.08