SCOPe 2.06: Domain d3q2sd_: 3q2s D:

Lineage for d3q2sd_ (3q2s D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d3q2sd_: 3q2s D: [265242]
   automated match to d2mpua_
   protein/RNA complex

Details for d3q2sd_

PDB Entry: 3q2s, 2.9 Å

PDB Description: crystal structure of cfim68 rrm/cfim25 complex

PDB Compounds: (D:) Cleavage and polyadenylation specificity factor subunit 6

SCOPe Domain Sequences for d3q2sd_:

Sequence; same for both SEQRES and ATOM records:

>d3q2sd_ d.58.7.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtpvnkqflsqfemqsr

Timeline for d3q2sd_:

• d3q2sd_ first appeared in SCOPe 2.05
  
• d3q2sd_ appears in SCOPe 2.07
  
• d3q2sd_ appears in the current release, SCOPe 2.08