SCOPe 2.05: Domain d3pzoa_: 3pzo A:

Lineage for d3pzoa_ (3pzo A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Thermotoga petrophila [TaxId:390874] [267872] (6 PDB entries)

8. Domain d3pzoa_: 3pzo A: [265239]
   automated match to d3ziza_
   complexed with gol, mal

Details for d3pzoa_

PDB Entry: 3pzo, 1.55 Å

PDB Description: structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with three maltose molecules

PDB Compounds: (A:) Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family 5

SCOPe Domain Sequences for d3pzoa_:

Sequence; same for both SEQRES and ATOM records:

>d3pzoa_ c.1.8.0 (A:) automated matches {Thermotoga petrophila [TaxId: 390874]}
frfigsnnyymhyksnrmidsvlesardmgikvlriwgfldgesycrdkntymhpepgvf
gvpegisnaqngferldytiakakelgikliivlvnnwddfggmnqyvrwfggthhddfy
rderikeeykkyvsflinhvnvytgvpyreeptimawelanelrcetdksgntlvewvke
mssyiksldpnhlvavgdegffsnyegfkpyggeaewayngwsgvdwkkllsietvdfgt
fhlypshwgvspenyaqwgakwiedhikiakeigkpvvleeygipksapvnrtaiyrlwn
dlvydlggdgamfwmlagigegsdrdergyypdydgfrivnddspeaelireyaklf

Timeline for d3pzoa_:

• d3pzoa_ is new in SCOPe 2.05-stable
  
• d3pzoa_ appears in SCOPe 2.06
  
• d3pzoa_ appears in the current release, SCOPe 2.08