SCOPe 2.05: Domain d3pqjd_: 3pqj D:

Lineage for d3pqjd_ (3pqj D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Xylella fastidiosa [TaxId:2371] [267870] (2 PDB entries)

8. Domain d3pqjd_: 3pqj D: [265207]
   automated match to d4k2ea_

Details for d3pqjd_

PDB Entry: 3pqj, 2.48 Å

PDB Description: Crystal Structure of the transcriptional repressor BigR from Xylella fastidiosa

PDB Compounds: (D:) Biofilm growth-associated repressor

SCOPe Domain Sequences for d3pqjd_:

Sequence, based on SEQRES records:

>d3pqjd_ a.4.5.0 (D:) automated matches {Xylella fastidiosa [TaxId: 2371]}
mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
resgivetrrnikqifyrlteakaaqlvnalytifc

Sequence, based on observed residues (ATOM records):

>d3pqjd_ a.4.5.0 (D:) automated matches {Xylella fastidiosa [TaxId: 2371]}
mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigiqqlgvlresgiv
etrrnikqifyrlteakaaqlvnalytifc

Timeline for d3pqjd_:

• d3pqjd_ is new in SCOPe 2.05-stable
  
• d3pqjd_ appears in SCOPe 2.06
  
• d3pqjd_ appears in the current release, SCOPe 2.08