Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:158080] [267864] (5 PDB entries) |
Domain d3pk7g1: 3pk7 G:3-113 [265194] Other proteins in same PDB: d3pk7a2, d3pk7b2, d3pk7c2, d3pk7d2, d3pk7e2, d3pk7f2, d3pk7g2, d3pk7h2 automated match to d4il2a1 complexed with gol, mg |
PDB Entry: 3pk7 (more details), 1.64 Å
SCOPe Domain Sequences for d3pk7g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pk7g1 d.54.1.0 (G:3-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]} lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3pk7g1: