SCOPe 2.05: Domain d3pk7e2: 3pk7 E:114-405

Lineage for d3pk7e2 (3pk7 E:114-405)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267865] (5 PDB entries)

8. Domain d3pk7e2: 3pk7 E:114-405 [265191]
   Other proteins in same PDB: d3pk7a1, d3pk7b1, d3pk7c1, d3pk7d1, d3pk7e1, d3pk7f1, d3pk7g1, d3pk7h1
   automated match to d4il2a2
   complexed with gol, mg

Details for d3pk7e2

PDB Entry: 3pk7, 1.64 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site

PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3pk7e2:

Sequence, based on SEQRES records:

>d3pk7e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d3pk7e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvepadsslpae
hvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledc
vpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrv
adlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfe
dghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Timeline for d3pk7e2:

• d3pk7e2 is new in SCOPe 2.05-stable
  
• d3pk7e2 appears in SCOPe 2.06
  
• d3pk7e2 appears in the current release, SCOPe 2.08