Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:158080] [267865] (5 PDB entries) |
Domain d3pk7e2: 3pk7 E:114-405 [265191] Other proteins in same PDB: d3pk7a1, d3pk7b1, d3pk7c1, d3pk7d1, d3pk7e1, d3pk7f1, d3pk7g1, d3pk7h1 automated match to d4il2a2 complexed with gol, mg |
PDB Entry: 3pk7 (more details), 1.64 Å
SCOPe Domain Sequences for d3pk7e2:
Sequence, based on SEQRES records: (download)
>d3pk7e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
>d3pk7e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvepadsslpae hvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledc vpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrv adlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfe dghflagespghgvdideelaakypyeraslpvnrledgtlwhw
Timeline for d3pk7e2: