Lineage for d3p93c1 (3p93 C:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948060Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)
  8. 2948095Domain d3p93c1: 3p93 C:4-113 [265163]
    Other proteins in same PDB: d3p93a2, d3p93a3, d3p93b2, d3p93b3, d3p93c2, d3p93c3, d3p93d2, d3p93d3, d3p93e2, d3p93e3, d3p93f2, d3p93f3, d3p93g2, d3p93g3, d3p93h2, d3p93h3
    automated match to d4il2a1
    complexed with cs2, kdg, mg

Details for d3p93c1

PDB Entry: 3p93 (more details), 1.8 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3p93c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p93c1 d.54.1.0 (C:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3p93c1:

Click to download the PDB-style file with coordinates for d3p93c1.
(The format of our PDB-style files is described here.)

Timeline for d3p93c1: