SCOPe 2.06: Domain d3ow1d1: 3ow1 D:4-113

Lineage for d3ow1d1 (3ow1 D:4-113)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)

8. Domain d3ow1d1: 3ow1 D:4-113 [265127]
   Other proteins in same PDB: d3ow1a2, d3ow1a3, d3ow1b2, d3ow1b3, d3ow1c2, d3ow1c3, d3ow1d2, d3ow1d3, d3ow1e2, d3ow1e3, d3ow1f2, d3ow1f3, d3ow1g2, d3ow1g3, d3ow1h2, d3ow1h3
   automated match to d4il2a1
   complexed with gol, mg, so4

Details for d3ow1d1

PDB Entry: 3ow1, 1.8 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens complexed with MG

PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3ow1d1:

Sequence; same for both SEQRES and ATOM records:

>d3ow1d1 d.54.1.0 (D:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

Timeline for d3ow1d1:

• d3ow1d1 first appeared in SCOPe 2.05
  
• d3ow1d1 appears in SCOPe 2.07
  
• d3ow1d1 appears in the current release, SCOPe 2.08