Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
Domain d3op5d_: 3op5 D: [265117] automated match to d4nt4a_ complexed with edo, gol, reb |
PDB Entry: 3op5 (more details), 2.4 Å
SCOPe Domain Sequences for d3op5d_:
Sequence, based on SEQRES records: (download)
>d3op5d_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngplftel kfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyea nakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayry cpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwedn lkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdil lqglkaigskddgkldl
>d3op5d_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgeiitdmaaaawkvglpiciyladmnssdapcvvkvepsplftelkfyqraakpeqiqk wirtrklkylgvpkywgsglhdngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlsl rildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhkayaadpkr chdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyvrdskiryr eniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglkaigskddgkl dl
Timeline for d3op5d_: