SCOPe 2.07: Domain d3nyua_: 3nyu A:

Lineage for d3nyua_ (3nyu A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225932] (10 PDB entries)

8. Domain d3nyua_: 3nyu A: [265093]
   automated match to d2ogea_
   complexed with edo, na

Details for d3nyua_

PDB Entry: 3nyu, 1.5 Å

PDB Description: x-ray crystal structure of the wbpe (wlbe) aminotransferase from pseudomonas aeruginosa as the plp internal aldimine adduct with lysine 185

PDB Compounds: (A:) Aminotransferase WbpE

SCOPe Domain Sequences for d3nyua_:

Sequence; same for both SEQRES and ATOM records:

>d3nyua_ c.67.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn

Timeline for d3nyua_:

• d3nyua_ first appeared in SCOPe 2.05
  
• d3nyua_ appears in SCOPe 2.06
  
• d3nyua_ appears in the current release, SCOPe 2.08