Lineage for d3nysa_ (3nys A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867852Species Pseudomonas aeruginosa [TaxId:208964] [225932] (4 PDB entries)
  8. 1867854Domain d3nysa_: 3nys A: [265091]
    automated match to d2ogea_
    complexed with na, plp; mutant

Details for d3nysa_

PDB Entry: 3nys (more details), 1.45 Å

PDB Description: x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution
PDB Compounds: (A:) Aminotransferase WbpE

SCOPe Domain Sequences for d3nysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nysa_ c.67.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
ffpsaplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn

SCOPe Domain Coordinates for d3nysa_:

Click to download the PDB-style file with coordinates for d3nysa_.
(The format of our PDB-style files is described here.)

Timeline for d3nysa_: